Description

Description:
Tirzepatide is a synthetic peptide composed of 39 amino acids, designed as a dual agonist of the glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors. This unique dual-receptor activity makes Tirzepatide a valuable research tool for exploring pathways related to glucose metabolism, insulin secretion, and energy balance. The molecule features structural modifications that enhance metabolic stability and prolong activity in controlled experimental conditions.

Research Applications:
Tirzepatide is commonly utilized in preclinical and in vitro research focused on:

• Investigating dual GIP/GLP-1 receptor signaling mechanisms
• Studying glucose homeostasis and insulin sensitivity
• Examining metabolic modulation and lipid metabolism pathways
• Evaluating structural optimization and peptide stability

Molecular Formula: C225H348N48O68
Molecular Weight: ≈4813.5 g/mol
Sequence: YXEGTFTSDYSIQLYTDLAGGQAAKEFIAWLVKGRG-NH₂
(Note: Y = C20 fatty diacid-modified lysine residue)

Form: Lyophilized powder
Purity: ≥ 98 % (HPLC)
Storage: Store at –20 °C. Avoid repeated freeze-thaw cycles.
Solubility: Soluble in sterile water or aqueous buffer

Handling and Use:
This material is supplied strictly for in vitro laboratory research. It is not for human consumption, veterinary use, or diagnostic applications. Appropriate laboratory safety procedures should be followed at all times.