Genrx Peptides

🚚 FREE SHIPPING on Orders $300+ | Ships from Florida in 24 Hours | USA Based

genrx-logo-new

Tirzepatide 20mg

$115.00

Tirzepatide 20 mg is a dual-receptor peptide analog designed for advanced investigation of glucose and lipid metabolic r

100 in stock

SKU: PEP1004 Category: Tags: , ,

Description

Description:
Tirzepatide 20 mg is a dual-receptor peptide analog designed for advanced investigation of glucose and lipid metabolic regulation. Acting as a dual agonist of the glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors, this research-grade material is suited for extended or higher-scale assays requiring enhanced study duration or compound volume. Structural lipidation and amino-acid substitutions improve receptor affinity, molecular stability, and plasma persistence under controlled experimental conditions.

Research Applications:
Tirzepatide 20 mg is utilized in preclinical and in vitro research focusing on:

  • Dual GIP/GLP-1 receptor signaling and metabolic modulation
  • Peptide-mediated insulin secretion and glucose homeostasis
  • Investigations of peptide half-life extension and stability optimization
  • Studies on lipid utilization and energy-balance regulation

Molecular Formula: C₂₂₅H₃₄₈N₄₈O₆₈
Molecular Weight: ≈ 4813.5 g/mol
Sequence: YXEGTFTSDYSIQLYTDLAGGQAAKEFIAWLVKGRG-NHâ‚‚
(Y = C20 fatty-diacid–modified lysine residue)

Form: Lyophilized powder
Purity: ≥ 98 % (HPLC)
Storage: Store at –20 °C. Avoid repeated freeze-thaw cycles.
Solubility: Soluble in sterile water or aqueous buffer

Handling and Use:
This compound is intended strictly for in vitro laboratory research. It is not for human consumption, veterinary use, or diagnostic applications. Standard laboratory protective protocols and aseptic techniques should be followed when handling all research peptides.

Additional information

Size

Reviews

There are no reviews yet.

Be the first to review “Tirzepatide 20mg”

Your email address will not be published. Required fields are marked *