Description
Description:
Tirzepatide 20 mg is a dual-receptor peptide analog designed for advanced investigation of glucose and lipid metabolic regulation. Acting as a dual agonist of the glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors, this research-grade material is suited for extended or higher-scale assays requiring enhanced study duration or compound volume. Structural lipidation and amino-acid substitutions improve receptor affinity, molecular stability, and plasma persistence under controlled experimental conditions.
Research Applications:
Tirzepatide 20 mg is utilized in preclinical and in vitro research focusing on:
- Dual GIP/GLP-1 receptor signaling and metabolic modulation
- Peptide-mediated insulin secretion and glucose homeostasis
- Investigations of peptide half-life extension and stability optimization
- Studies on lipid utilization and energy-balance regulation
Molecular Formula: C₂₂₅H₃₄₈N₄₈O₆₈
Molecular Weight: ≈ 4813.5 g/mol
Sequence: YXEGTFTSDYSIQLYTDLAGGQAAKEFIAWLVKGRG-NHâ‚‚
(Y = C20 fatty-diacid–modified lysine residue)
Form: Lyophilized powder
Purity: ≥ 98 % (HPLC)
Storage: Store at –20 °C. Avoid repeated freeze-thaw cycles.
Solubility: Soluble in sterile water or aqueous buffer
Handling and Use:
This compound is intended strictly for in vitro laboratory research. It is not for human consumption, veterinary use, or diagnostic applications. Standard laboratory protective protocols and aseptic techniques should be followed when handling all research peptides.

Reviews
There are no reviews yet.